New to this blog?

Thursday, February 28, 2013

Bhagavad Gita Verse 23, Chapter 14

udaaseenavadaaseeno gunairyo na vichaalyate |
gunaa vartante ityeva yovatishthathi nengate || 23 ||

 
One who is sits like an indifferent person, is not agitated by the gunas, who, knowing that the gunas interact with each other, is firmly situated and does not move.
 
udaaseenavat : indifferent person
aaseenaha : seated
gunaihi : through gunaas
yaha : one who
na : not
vichaalyate : agitated
gunaaha : gunas
vartante : interact
iti : in this manner
eva : only
yaha : one who
avatishthathi : situated firmly
na : does not
ingate : move
 
Previously, Shri Krishna indicated the mental state of one who has transcended the gunas. He now addresses the second question - how does one who has gone beyond the gunas behave in this world. He says that such a person lives life with ease and grace. He is like the graceful elephant who walks on the road, unaffected by the horde of dogs that is barking at him. We have come across such people ourselves, who remain calm and unperturbed even when facing their darkest personal challenges.
 
What makes a person so calm? There are two factors. First, even though such a person may not look like a monk from the outside, he has a great deal of detachment towards the world. Second, such a person is seated on an unshakeable platform, his own self. Both factors are possible through the conviction and constant awareness that the entire world, including one’s own body, is a play of the three gunas. It is the difference between getting swept away by the waves or sitting calmly on the beach. It is the difference between participating in a street fight or observing the fight from a second floor balcony.
 
What does all this mean in practice? It means when our mind is agitated, we will not crave for a peaceful state. We will accept that a certain level of agitation, a certain level of rajas is part and parcel of daily life. We will simply watch that mental state arise, persist, and go away, only to be replaced by another state. We will view the whole world as the gunas interacting with the gunas. The "I" within us will be firmly seated in itself, with a healthy level of distance and detachment from the movement of those gunas. It will stop identifying, giving importance, giving reality to the play of gunas. The gunas will move, but the "I" within us will not.

Wednesday, February 27, 2013

Bhagavad Gita Verse 22, Chapter 14

Shree Bhagavaan uvaacha:
prakaasham cha pravrittim cha mohameva cha paandava |
na dveshti sampravrittaani na nivrittaani kaankshati || 22 ||

 
Shree Bhagavaan said:
When light, activity and delusion are present, O Paandava, he does not hate them, nor does he yearn for them when they are absent.

 
prakaasham : light
cha : and
pravrittim : activity
cha : and
moham : delusion
eva : even
cha : and
paandava : O Paandava
na : not
dveshti : hate
sampravrittaani : present
na : not
nivrittaani : absent
kaankshati : yearn
 
Shri Krishna answers Arjuna’s question - what are the marks of one who has transcended the gunas - in this shloka. Light, activity and delusion refer to sattva, rajas and tamas respectively. One who is indifferent to the rise and fall of each guna, one who has a high degree of detachment and discrimination, one who lets the gunas come and go with ease, such a person has transcended the gunas. It is the difference between one who observes suitcases on an airport conveyor belt versus one who holds on to a suitcase and doesn’t let go. The one who insists on holding on gets pulled away.
 
When we are on vacation, our mind feels peaceful and relaxed. But when we come back from vacation, our mind becomes agitated since it has to get back to the nine to five routine of life. We want to hold on to that state of mind we had experienced when we were on vacation. In other words, we have an insistence, also known as aagraha, to hold on to a sattvic state when rajas comes in. Or when the alarm bell rings in the morning, we want to hold on to that sleepy tamasic state as long as possible, and not leave the bed. This aagraha, this insistence on holding on to one guna and not accepting the arrival of another guna, enables the gunas to control us. One who has transcended the gunas has given up this insistence through extreme vairagya or detachment.
 
Let’s look at it in another way. When we read comics, we can see what the characters are thinking through thought bubbles. For example, if Veronica insulted Archie, Archie would have a thought bubble that says "I feel so bad". We temporarily feel sorry for Archie, and move on to the next frame in the comic. But if someone insults us in real life, we don’t usually move on that quickly. We hold on to that thought, as well as the tamasic or rajasic state of mind created by that thought, for weeks, months, or years to come. And that is not all. We bring up that mental state each time we meet the person who insulted us.
 
When we are able to treat our thoughts with the same detachment that we do when we are reading other people’s thoughts in comic books, we will know that we have gone beyond the gunas.

Tuesday, February 26, 2013

Bhagavad Gita Verse 21, Chapter 14

Arjuna uvaacha:
kairlingaistreengunaanetaanateeto bhavati prabho |
kimaachaaraha katham chaitaanstreengunaantivartate || 21 ||

 
Arjuna said:
By which signs is the one who has gone beyond the three gunas known, O Lord? What is his behaviour, and how does he transcend these three gunas?

 
kaihi : which
lingaihi : signs
treen : three
gunaan : gunas
etaan : these
ateetaha : one who has gone beyond
bhavati : is
prabho : O Lord
kimaachaaraha : what is his behaviour
katham : how
cha : and
etaan : these
treen : three
gunaan : gunas
ativartate : transcend
 
We hear Arjuna speak after a long time in this shloka. Arjuna usually speaks when he needs to clarify a doubt, or when he thinks that he needs a more practical version of what he has just heard. We have seen this happen several times. In the second chapter, Arjuna wanted to know the marks of the person who is established in knowledge, sthitha prajnya. Arjuna also asked the signs of a perfected devotee in the chapter on bhakti yoga. Every time he has asked a question, we as listeners have benefitted tremendously.
 
Having heard a detailed explanation around the three gunas, but only a couple of shlokas on the person who transcends those gunas and attains immortality, Arjuna found it appropriate to ask a question at this juncture. He wanted to know three things. First, how does one know that a person has transcended the three gunas. Second, how does such a person behave in the world. Third, how does he actually transcend the three gunas.
 
We have to constantly remind ourselves that everything we learn from this chapter is purely for self-analysis, not for judging or evaluating someone else. The only person that can accurately determine whether our mental state is sattvic, rajasic or tamasic is none other than ourselves. There is another aspect to learning about the signs of one who has gone beyond the influence of the gunas. Until we reach the state of liberation, these signs are attributes that we should aspire to cultivate in our lives.

Monday, February 25, 2013

Bhagavad Gita Verse 20, Chapter 14

gunaanetaanateetya treendehee dehasamudbhavaan |
janmamrityujaraaduhkhaurvimuktomritamashnute || 20 ||

 
Having gone beyond these three gunaas, the creators of the body, the body dweller is freed from sorrow of birth, death and old age, and attains immortality.
 
gunaan : of the gunaas
etaan : these
ateetya : gone beyond
treen : three
dehee : body dweller
dehasamudbhavaan : creators of the body
janmamrityujaraaduhkhaihi : sorrows of birth, death and old age
vimuktaha : freed
amritam : immortality
ashnute : attains
 
Shri Krishna now conveys the gist of the fourteenth chapter in this shloka. He says that Prakriti, which is comprised of the three gunaas, creates this entire universe, including our body. As long as the individual soul, the jeeva, the body dweller identifies with this body and gives reality to it, he experiences sorrows throughout his life. Once the jeeva stops identifying with the body which is the product of the three gunaas, he attains liberation and becomes immortal.
 
This shloka also connects the main theme of the prior chapter to this chapter. In the thirteenth chapter, we learnt that ignorance of our true nature creates an entity called the Purusha, which in essence is nothing but a bundle of unfulfilled desires. Now here, we learn that these unfulfilled desires, also known as avidyaa, ignorance or maaya, attract a combination of sattva, rajas and tamas that becomes the physical body. Only when the Purusha severs his connection with this body by rising above the three gunaas, he realizes his true nature as the eternal essence.
 
Immortality in this context does not mean physical immortality. The body follows the laws of nature. Everything in nature has to perish, including our physical body. From the perspective of Prakriti, the body will die. But the dehi, the body dweller, having gone beyond the three gunas, having stopped identifying with the three gunas, knows that he is untouched and unaffected by the laws of Prakriti. For him, the modifications of the body such as old age and disease are as if they are happening to some third party. This ultimate freedom from the influence of the Prakriti is what makes him immortal.

Sunday, February 24, 2013

Bhagavad Gita Verse 19, Chapter 14

naanyam gunebhyaha kartaaram yadaa drishtaanupashyati |
gunebhyashcha param vetti madbhaavam sodhigacchati || 19 ||

 
When the beholders views no other doer than the gunaas, and knows himself as transcending the gunaas, he attains my nature.
 
na : no
anyam : any other
gunebhyaha : gunaas
kartaaram : doer
yadaa : when
drishtaa : beholder
anupashyati : views
gunebhyaha : gunaas
cha : and
param : transcending
vetti : knows
madbhaavam : my nature
saha : he
adhigacchati : attains
 
Let us now introduce a new character into our recurring example, a CEO of a television channel. He is the father of the young child who, as we have seen earlier, is addicted to watching boxing matches. These matches are broadcast on the very same channel that the CEO owns. What is the difference between the child and the CEO? The CEO has set up the machinery of the television channel. He knows how the shows are recorded, edited and broadcast. When he comes home, he watches the channel as a detached observer. But the child, due to his addiction, gets affected by the blows received by the boxer in the boxing match.
 
The CEO keeps reminding his son to not get so attached to the boxing match since it is not real, it is just a television program. Once the child has identified himself as the boxer, he will have to accept all the consequences of that character in that particular TV show. In the same way, Shri Krishna urges us to not get trapped in the machine called Prakriti. If we identify with Prakriti, which is nothing but the three gunas, then we have to accept all its laws including birth, death, rebirth, joy, sorrow and so on. We have to understand that we neither do anything, nor do we experience the result of our actions. All action and reaction is within the realm of Prakriti. Once we establish ourselves as a witness, we understand that we have incorrectly taken on action and reaction upon ourselves.
 
Knowing this reality, however, does not mean that Prakriti will go away. Even if the child has stopped identifying with the boxer, the boxing match will be broadcast every day at 8 PM. Similarly, even if we are not bound by it, Prakriti will be tangible and visible to us during our waking hours. The entire universe, including the body that we are identified with, is made up of the three gunas of Prakriti. But despite it appearing to us as an apparent reality, Prakriti will be unable to bind us with its laws once we recognize it as an illusion, and not as reality. Once we are able to rise beyond identification with the three gunas, we will see Prakriti the way Ishvara sees Prakriti, as a detached observer. In this manner, when we realize our identity with Ishvara, we will attain the state of liberation, of self realization.

Saturday, February 23, 2013

Bhagavad Gita Verse 18, Chapter 14

oordhvam gacchanti sattvasthaa madhye tishtanti raajasaahaa |
jaghanyagunavrittisthaa adho gacchanti taamasaahaa || 18 ||

 
Those established in sattva go upwards, those in rajas stay in the middle. Those under the influence of the lowest guna, established in tamas, go downwards.
 
oordhvam : upwards
gacchanti : go
sattvasthaa : established in sattva
madhye : middle
tishtanti : stay
raajasaahaa : established in rajas
jaghanya : lowest
gunavrittisthaahaa : influence of guna
adhaha : downwards
gacchanti : go
taamasaahaa : established in tamas
 
Parents are always watchful of their children’s behaviour, because the values that are inculcated in childhood stay with us throughout our life. If parents notice that their child is lazy and remains idle all the time, they will first motivate him through selfish desires. They will teach him that if he studies hard and works hard, he will be able to buy fast cars, electronic gadgets, a big house and so on. Once he has risen from a tamasic state to a rajasic state, and has made enough money, his parents will encourage him to slowly start transitioning from rajasic action to selfless, sattvic actions like donating money to charity, volunteering and so on.
 
Shri Krishna gives us a similar roadmap for our evolution in this shloka. He says that once we have determined our degree of rajas and tamas, we should consciously perform the actions necessary to uplift our mental state. If we are primarily tamasic in nature, we should perform rajasic actions. If we are primarily sattvic in nature, we should perform sattvic actions. He also puts the responsibility of self improvement squarely on our shoulders. No other person can make this happen. The will to self improve must come from within.
 
Let us imagine for a moment that we are able to uplift ourselves to the level of sattva, where we are able to remain in a sattvic state for a majority of the day, as a consequence of performing sattvic, selfless actions. Is this our goal, or is this yet another milestone in our spiritual journey? The thirteenth chapter taught us that we have become the individual soul, the jeeva, the Purusha, by forgetting our true nature as the eternal essence. We have further become entangled in Prakriti by identifying with a mind and body that are under the influence of the gunas. Once we are able to stay in sattva, and minimize the effects of rajas and tamas, how do we then disentangle ourselves from Prakriti? Shri Krishna picks up this topic next.

Friday, February 22, 2013

Bhagavad Gita Verse 17, Chapter 14

sattvaatsanjaayate jnyaanam rajaso lobha eva cha |
pramaadamohau tamaso bhavatojnyaanameva cha || 17 ||

 
From sattva arises wisdom, and rajas from greed. Heedlessness, error as well as ignorance arise from tamas.
 
sattvaa : from sattva
sanjaayate : arises
jnyaanam : knowledge
rajasaha : rajas
lobha : greed
eva : also
cha : and
pramaadamohau : heedlessness and error
tamasaha : tamas
bhavataha : arises
ajnyaanam : ignorance
eva : also
cha : and
 
Previously, we took the example of people who make it a habit to go to the gym everyday, and eventually make it into an integral part of their lives. If we fast forward that example a few months further, we find that these people have lost weight, they are taking care of their body, they are eating healthy, avoiding smoking and so on. Their persistence in getting over the initial pain of going to the gym has paid off. They enjoy the state being healthy and being fit. Intelligent action has shaped their physical state, and consequently, the physical state gives its result.
 
Similarly, mental states that were shaped by intelligent actions give results as well. Shri Krishna says that sattvic mental state gives us access to material and spiritual knowledge, since our intellect improves its ability to think clearly and grasp information quickly. A rajasic mental state makes us act in the world to rush after objects. We want objects we do not have, and want more of objects that we already have. A tamasic mental state has the worst possible outcome. It keeps us steeped in ignorance of the material world, and of our true nature. We do not want to act at all, and even if we do, we perform furtile actions, or perform careless actions.
 
This shloka and the prior shloka point out the self reinforcing nature of actions and gunaas. If we consciously perform sattvic actions day after day, we will generate a greater proportion of sattva in our mind, which will further spur sattvic actions. This is the logic behind karma yoga. By urging us to perform selfless actions, Shri Krishna wants us to rise from our rajasic and tamasic existence to one of greater sattva.

Thursday, February 21, 2013

Bhagavad Gita Verse 16, Chapter 14

karmanaha sukritasyaahuhu saattvikam nirmalam phalam |
rajasastu phalam duhkhamajnyaanam tamasaha phalam || 16 ||

 
The result of good action is sattvik and pure, it is said, while the result of rajas is sorrow, and the result of tamas is ignorance.
 
karmanaha : action
sukritasya : good
aahuhu : is said
saattvikam : sattvik
nirmalam : pure
phalam : result
rajasaha : rajas
tu : while
phalam : result
duhkham : sorrow
ajnyaanam : ignorance
tamasaha : tamas
phalam : result
 
When new year comes around, many people make new year resolutions to lose weight. Many take a gym membership, but most end up using it only for a few days. The ones that consciously develop a habit of going to the gym everyday are the most likely to lose weight. Even if they go to the gym for ten minutes every day, they will lose weight. This is because habits are self reinforcing. A behaviour creates a habit, which pushes us to repeat the behaviour, which strengthens the habit, and so on.
 
Similarly, we can shape our mental states by choosing our actions consciously. Shri Krishna says that sattvic or selfless actions generate a sattvic state, rajasic or selfish actions generate a rajasic state, and tamasic or ignorant actions generate a tamasic state. If we are predominantly rajasic by nature, we can improve our state by emphasizing the performance of sattvic actions. If we are predominantly tamasic by nature, we can change it by emphasizing the performance of rajasic actions.
 
The law of karma holds true in every situation, including this one. If we perform rajasic actions, we will attain temporary joy, which will eventually generate sorrow. It does not take a large amount of raaga dvesha, likes or dislikes, to make us act selfishly. And if we perform tamasic actions, we will continue to live our lives in inertness and ignorance. Only through sattvic actions will we create a state of purity and serenity in our mind.

Wednesday, February 20, 2013

Bhagavad Gita Verse 15, Chapter 14

rajasi pralayam gatvaa karmasangishu jaayate |
tathaa praleenastamasi moodhayonishu jaayate || 15 ||

 
One who has reached his end in rajas is born among those attached to action, and one who is dying in tamas is born in the wombs of the ignorant.
 
rajasi : rajas
pralayam : end
gatvaa : one who has reached
karmasangishu : those who are attached to action
jaayate : born
tathaa : and
praleenaha : one who is dying
tamasi : tamas
moodhayonishu : ignorant wombs
jaayate : born
 
Previously, Shri Krishna explained the fate of one whose mental state is sattvic at the end of his life. Here, he says that one whose mental state is rajasic while dying is reborn in a family of action oriented individuals. Also, one whose mental state is tamasic while dying is reborn in the wombs of the ignorant and the inert. This includes plants, trees, creepers, birds, insects and other animals.
 
It is not just the mental state that determines one’s fate in the next life. Every action we perform leaves impressions in our mind, which also impacts our fate. One who has performed selfless actions throughout their life is born in a virtuous family. One who has performed selfish actions is born with a tendency to get attached to material objects. And one who has performed harmful actions is born with devilish tendencies. Such a person will not stop at anything to get their way, including physically harming others. In their current life and in their next life, it is totally up to each individual to cultivate their discrimination through selfless service, devotion and company of devotees so that they can counteract the effect of excessive rajas.
 
The Srimad Bhagavatam tells the story of the illustrious king Bharata who was one of the most sattvic individuals of his time. Through extreme attachment to his pet deer, he became steeped in tamas, and was born as a deer in his next life. But due to the selfless actions performed in his life as a king, he developed a degree of renunciation not even found in humans. He was finally born as a highly sattvic human who ultimately achieved liberation. Shri Krishna repeatedly urges us to employ rajas to perform selfless service, and cultivate sattva through reducing selfish activities.

Tuesday, February 19, 2013

Bhagavad Gita Verse 14, Chapter 14

yada sattve pravriddhe tu pralayam yaati dehabhrita |
tadottamavidaan lokaanamalaanpratipadyate || 14 ||

 
When sattva is predominant, and the body dweller reaches his end, then he attains the immaculate worlds of the knowers of the highest.
 
yada : when
sattve : sattva
pravriddhe : predominant
tu : and
pralayam : end
yaati : reaches
dehabhrita : body dweller
tadaa : then
uttamavidaan : knowers of the highest
lokaan : worlds
amalaan : immaculate
pratipadyate : attains
 
Now, Shri Krishna explains the effects of each gunaa from the perspective of reincarnation. He says that one whose mind is in a sattvic state during the time of death travels to realms that are subtler than the human world. These realms are termed as “Brahmaloka”, the abode of Lord Brahma. It is said that there is no room for any desire, sorrow or disease in such realms, given the complete absence of rajas or tamas. Such people, however, are still subject to the bondages caused by sattva, as discussed previously.
 
Let us revisit the example of the young child who has developed a strong identification with a television character played by the actor “ABC”. ABC’s run as an action hero in a popular TV show has ended. He has decided to play the role of a serious professor in his new TV series. The young child now has a choice. He can either continue to identify with ABC in his new role as a professor, or find another TV show with an action hero to identify with. The choice depends on the young child’s mental state. If it is heavily rajasic, he will find another action hero. If it has some sattva, he will follow ABC as a professor.
 
Similarly, our desires and thoughts, which are driven by the gunaas that influence us, will determine our fate after this physical body drops. The subtle body, which is nothing but our desires and thoughts, will attract another physical body that enables it to carry out those desires. It is almost similar to DNA shaping a body based on the programming it contains. Therefore, if our subtle body harbours sattvic thoughts, it will gain entry into a highly sattvic body after death. But if it continues to harbour rajasic or tamasic thoughts, it will obtain a different destination. This is explained in the next shloka.

Monday, February 18, 2013

Bhagavad Gita Verse 13, Chapter 14

aprakaashopravrittishcha pramaado moha eva cha |
tamasyetaani jaayante viviriddhe kurunandan || 13 ||

 
Darkness, inaction, heedlessness and also error. These arise when tamas is predominant, O descendant of the Kurus.
 
aprakaashaha : darkness
apravrittihi : inaction
cha : and
pramaadaha : heedlessness
mohaha : error
eva : also
cha : and
tamasi : of tamas
etaani : these
jaayante : arise
viviriddhe : predominant
kurunandan : O descendent of the Kurus
 
Shri Krishna addressed Arjuna as "kurunandana" when explaining the marks of tamas, but addressed him as "bharatarshabha" when explaining the marks of rajas. He was probably hinting that some members of the Kuru dynasty, the Kauravas, were under the influence of tamas. When we are under the influence of tamas, we make erroneous decisions. We become inert like a stone, resorting to inaction. Even when we act, it is out of heedlessness. Our knowledge is covered by tamas, creating darkness within us.
 
Let us go deeper into what inaction really means. When we have a lack of drive to achieve anything in the world, when we wants to escape all sense of responsibilities, when all ambitions go away, that is inaction. Moha, error or delusion is even worse. We cannot accurately judge our relationship with the world, with other people, with our family, our friends, our job and so on. We become a "good for nothing", and will remain in that state unless someone wakes us up.
 
Nature has its own scale of tamas, rajas and sattva. It is better to crawl like an insect than lie around like a stone, better to work like an ant rather than crawl like an ant, better to pollinate flowers like a bird than simply work like an ant, better to give milk to others like a cow than pollinate flowers like a bird, and it is better to work with one’s intellect like a human than to give milk to others like a cow. So one who is steeped in tamas, should start to act, even if the actions are without any planning or thinking, just to get into a higher mental state.

Sunday, February 17, 2013

Bhagavad Gita Verse 12, Chapter 14

lobhaha pravrittiraarambhaha karmanaamashamaha spruhaa |
rajasyetaani jaayante vivriddhe bharatarshabha || 12 ||

 
Greed, activity, commencement of actions, unrest, desire. These arise when rajas is predominant, o foremost among the Bharataas.
 
lobhaha : greed
pravrittihi : activity
araarambhaha : commencement
karmanaam : actions
ashamaha : unrest
spruhaa : desire
rajasi : of rajas
etaani : these
jaayante : arise
vivriddhe : predominance
bharatarshabha : O foremost among the Bharataas
 
Shri Krishna addressed Arjuna as “bharatarshabha”, the foremost scion of the Bharata dynasty, and enumerates the marks of a person who is under the influence of raajas. He says that whenever our mind generates thoughts of greed, selfish activity, commencement of action, unrest or uneasiness, and desire for even trivial things, we should realize that we are under the sway of rajas. In fact, we consider this to be our natural state of mind, especially during the waking hours of the day.
 
If we look at the first half of the shloka in reverse order, we start with spruha, which is a selfish desire for objects that have nothing to do with our duties, like a gold watch. Frequent thoughts for acquiring the gold watch lead to ashama or restlessness, where we are not satisfied with our present situation and want to do something else. We then begin to act, karmanaam aarambha, so that we can acquire this gold watch. Our plans may lead us to do another part time job or withdraw from our savings, which is pravritti, engaging in selfish action. Even after we acquire the gold watch, we are not satisfied and want another one. That is lobha, greed, the height of rajasic influence on our mind.
 
It is not easy to detect whether our actions are prompted by selfishness or not. Only a pure mind that has been cleansed of selfishness through karma yoga, with the aid of a guru, can recognize the subtle difference between sattvic and rajasic actions. Karma yoga teaches us to analyze our qualification and proclivity for selecting an appropriate vocation. If we are trained to become an actor, and are also passionately interested in acting, then that becomes our vocation. There is a baseline level of rajas needed to perform actions towards fulfilling the duties of our vocation, which is perfectly fine. Shri Krishna says that we need to watch for signs where rajas increases beyond that baseline level, where selfishness creeps into our actions.

Saturday, February 16, 2013

Bhagavad Gita Verse 11, Chapter 14

sarvasvaareshu dehesminprakaasha upajaayate |
jnyaanam yadaa tadaa vidyaadvivriddham sattvamityuta || 11 ||

 
When luminous knowledge radiates through all gates of this body, then one should know that sattva has increased greatly.
 
sarvasvaareshu : in all gates
dehe : body
asmin : this
prakaashaha : luminous
upajaayate : radiates
jnyaanam : knowledge
yadaa : when
tadaa : then
vidyaat : one should know
vivriddham : increased
sattvam : sattva
iti : this
uta : definitely
 
What are the marks of sattva? Shri Krishna says that when we see radiance, or when we see knowledge radiating from a person, we should know that we are in the presence of a highly sattvic person. The word “dvaara” usually means door or gate, but here it refers to the sense organs, our doors to the world. Even though the sense organs are meant from receiving stimuli from the world, they can also convey our internal state to the world. Our eyes, especially, can give away our thoughts. If our mind is wandering, our eyes will also wander, for instance. In a sattvic person, radiance shines through the sense organs, especially the eyes.
 
Now, we should not think that a highly sattvic person will radiate beams of light from their body. But they do radiate calmness and peace. We can sense peace if we are near them, or pick up on their calmness if we are watching them on a screen. Watch Dr. Jane Goodall speak about her efforts to save gorillas in Africa, and you will be drawn to the serenity on her face instantly. Such people harbour few, if any, selfish desires in their mind. This lack of dirt in the form of selfishness lets their inner radiance, the light of their eternal essence, shine through.
 
From our perspective, whenever we notice an increase in clear thinking, we should know that sattva is predominant in our mind. If we see fried food but the intellect prevents our hand from reaching to pick up that food, we are in a sattvic state. If our thoughts are towards the well-being of the family, our city or our nation, instead of just our narrow well-being, we are in a sattvic state. If our mind is sharp and alert, if we don’t let anything drop in our personal and professional lives, we are in a sattvic state.

Friday, February 15, 2013

Bhagavad Gita Verse 10, Chapter 14

rajastamaschaabhibhooya sattvam bhavati bhaarata |
rajaha sattvam tamaschaiva tamaha sattvam rajastathaa || 10 ||

 
Sattva rises, O Bhaarata, when it overpowers rajas and tamas, so does rajas overpower sattva and tamas, and also tamas overpowers sattva and rajas.
 
rajas : rajas
tamas : tamas
cha : and
abhibhooya : overpowers
sattvam : sattva
bhavati : rises
bhaarata : O Bhaarata
rajaha : rajas
sattvam : sattva
tamas : tamas
cha : and
eva : similarly
tamaha : tamas
sattvam : sattva
rajas : rajas
tathaa : similarly
 
Now that we have a basic understanding of the properties of the three gunaas, we need to go one level deeper. We know that our mind is always under the influence of the three gunaas, since it is made up of those very three gunaas. How do these three gunaas impact the mind? Do they work in parallel or do they work in sequence? Is there any one gunaa that is more powerful than the other?
 
Shri Krishna says that our mind can only be under the impact of one gunaa at a time. This happens when one gunaa assumes dominance, and consequently, asserts its authority over the others. When sattva is dominant, it dominates over rajas and tamas. Similarly, rajas dominates over the other two and tamas over the other two. All three gunaas are at war with each other in our mind. When one gunaa achieves victory, it temporarily defeats the others.
 
Having known this, we now would like to know which gunaa within us dominates more than others. This is not an easy question to answer, because we have to analyze ourselves and not anyone else. We need to look within. We need to understand what thoughts, feelings and emotions should we watch out for so that we can tie them back to a specific gunaa. If we conduct this analysis for a while, we will know which gunaa predominates. Shri Krishna expands on the topic of the marks or signs of each gunaa in the next shloka.

Thursday, February 14, 2013

Bhagavad Gita Verse 9, Chapter 14

sattvam sukham sanjayati rajaha karmani bhaarata |
jnyaanamaavritya tu tamaha pramaade sanjayatyuta || 9 ||

 
Sattva binds through joy, rajas through action, O Bhaarata, while tamas cloaks knowledge and binds through heedlessness.
 
sattvam : sattva
sukham : joy
sanjayati : binds
rajaha : rajas
karmani : action
bhaarata : O Bhaarata
jnyaanam : knowledge
aavritya : cloaks
tu : while
tamaha : tamas
pramaade : heedlessness
sanjayati : binds
uta : and
 
Shri Krishna recaps the characteristics of the three gunaas in this shloka. Sattva binds by making us hold on to joy experienced after attaining a sense object. Rajas binds us by giving us joy in performing actions and obtaining their results. Tamas binds us by giving us joy in holding on to laziness and heedlessness. We now begin to look into how these three are interrelated.
 
In the second chapter, we have come across a series of shlokas that describe how the mind can fall from sattva into rajas and tamas in a matter of seconds. We start with the mind resting in a peaceful sattvic state. A tinge of rajas comes in, causing us to think about some sense object, let's say a sweet. This fuels rajas further, creating a strong attachment to that sweet, culminating in a strong desire to do anything to get that sweet. But it gets worse. If we cannot get that sweet, if someone or something obstructs our consumption of the sweet, anger arises in us. Rajas deteriorates into tamas. The last rung of the ladder of fall is when anger goes to such an extent that it causes us to lose our faculty of intelligence and memory.
 
Conversely, we can go from tamas to rajas to sattva, but it may take a little longer. For someone steeped in tamas, immersing themself in action will raise them to the level of rajas. When action becomes focused and directed towards the pursuit of a selfless goal, rajas is elevated to the level of sattva. Swami Vivekananda always used to say "awake, arise, stop not till the goal is reached". When India was under British rule, many had become accustomed to this slavery and had fallen into a tamasic state. They could not find a way out of their predicament, and were clouded in ignorance. Swami Vivekananda's message urged citizens to engage in action towards independence. That was the only way to get them out of the tamasic state of laziness.

Wednesday, February 13, 2013

Bhagavad Gita Verse 8, Chapter 14

tamastvajnyaanajam viddhi mohanam sarvadehinaam |
pramaadaalasyanidraabhistannibadhnaati bhaarata || 8 ||

 
And, know tamas to be born of ignorance, deluding all the body dwellers. It binds them through heedlessness, laziness and sloth, O Bhaarata.
 
tamaha : tamas
tu : and
ajnyaanajam : born of ignorance
viddhi : know
mohanam : delude
sarvadehinaam : all body dwellers
pramaada : heedlessness
aalasya : laziness
nidraabhihi : through sloth
tat : it
nibadhnaati : binds
bhaarata : O Bhaarata
 
Tamas is our state of mind when it is dull and inert. Like a glass of dirty water cannot let light shine through, tamas prevents our mind from thinking clearly. Our mind starts to operate in moha, which means confusion or error, mistaking one thing for another. Tamas can be triggered by an overpowering emotional situation like Arjuna seeing his family members and loved ones on the opposite side of the battlefield. A tamasic state can also be triggered by abusing our sense organs through excessive drinking, smoking, watching TV and so on.
 
After a long and tiring day, when we want to rush to get a good night’s sleep, we get a call from a friend who wants to catch up. Try as we might, we will not be able to understand what he is saying because the mind has switched to a tamasic state due to exhaustion. Our memory does not work properly and our intellect’s logic is flawed. All we want to do is to rest our head on the pillow. When tamas reaches the height of its potency, we fall asleep.
 
Shri Krishna says that tamas is born out of ignorance. At its core, tamas keeps the Purusha, the jeeva, body dweller under the delusion that he is the body and not the self. When we forget our true nature as the self, the eternal essence, we assume that our body is who we are. This erroneous notion, this ignorance enables tamas to bind us, to trap us.
 
Tamas binds us in three ways, through heedlessness, laziness and sloth. Heedlessness is the performance of actions without intellectual focus or awareness. We either perform actions carelessly, such as dialing the wrong phone number, or perform actions that are futile, such as gambling or excessive alcohol consumption. Laziness is postponing or abstaining from our duties. Sloth is lying around in a state of stupor or sleep. Now, there is a place for resting and sleeping in our life, which is at the end of every day. But some of us derive joy from futile actions, from procrastination, from lazing around and so on. It is this joy through which tamas binds us.

Tuesday, February 12, 2013

Bhagavad Gita Verse 7, Chapter 14

rajo raagaatmakam viddhi trishnaasangasamudhbhavam |
tannibandhaati kaunteya karmasangena dehinam || 7 ||

 
Know rajas to be of the nature of passion, the source of thirst and attachment. It binds the body dweller by attachment to action, O Kaunteya.
 
rajaha : rajas
raagaatmakam : nature of passion
viddhi : know
trishnaa : thirst
sanga : attachment
samudhbhavam : source
tat : it
nibandhaati : binds
kaunteya : O Kaunteya
karmasangena : attachment to action
dehinam : body dweller
 
Rajas is our state of mind when it is agitated, like a glass of water that is being stirred. Imagine that we have to attend an extremely important meeting at 5 PM. It is 4:50 PM and the taxi is stuck in a traffic jam. Our mind will be in a state of rajas. A series of thoughts will suggest that we wait in the car, while another series of thoughts will suggest that we leave the taxi and start walking. Whenever our mind is agitated by a thoughts that propel us to act, we are in a state of rajas.
 
Shri Krishna says that rajas creates trishnaa or thirst for what we do not possess, and sanga or attachment towards what we already possess. Furthermore, rajas creates a vicious cycle. It fuels our desires, creates thoughts that compel us to act so that we can acquire objects, then it creates attachment to those objects which further increases rajas. Typically, rajas dominates our mind from sunrise until sunset.
 
To understand how rajas can bind, consider the case of a multi-millionaire who has recently married his young girlfriend. The millionaire is self sufficient and does not need to work to support himself. But his wife’s brothers, relatives, friends and acquaintances slowly approach him for capital to start their business, connections to get them jobs, advice on their career and so on. Soon, the millionaire ends up working all day, every day. Even though the millionaire does not need to move a finger, he gets bound by his relationship to his wife.
 
Similarly, even though the self, the "I" does not act, rajas binds the self through attachment to action and its results. It makes us say "I am the doer" and "I am the enjoyer" whereas it is actually Prakriti that is acting and providing the results. Karma yoga helps us come out of this bondage and entrapment. It teaches us to continue to act in this world, but do it in a way that removes our identification with Prakriti. We slowly start submitting the results of our actions to Ishvara, then we slowly start letting Ishvara take over the doership of our actions as well.

Monday, February 11, 2013

Bhagavad Gita Verse 6, Chapter 14

tatra sattvam nirmalatvaatprakaashamanaamayam |
sukhasangena badhnaati jnyaanasangena chaanagha || 6 ||

 
Of these, sattva is pure, bright and healthy. It binds through attachment to joy and attachment to knowledge, O sinless one.
 
tatra : of these
sattvam : satvva
nirmalatvaat : pure
prakaasham : bright
anaamayam : healthy
sukhasangena : attachment to joy
badhnaati : binds
jnyaanasangena : attachment to knowledge
cha : and
anagha : O sinless one
 
In simple terms, our mind is in a state of sattva whenever we experience joy, peace and calmness. We are alert, our mind is able to think very logically, we are able to grasp the most complex statements that we read or hear, and we don’t feel the need to rush out into the world.
 
Shri Krishna says that sattva refers to purity, brightness and health. Our mind can be compared to the water in a glass cup. When the pond is free from agitation, and all the dirt has settled down, it is crystal clear and is able to reflect light beautifully. Similarly, when our mind is in a state of sattva, there is absence of dirt in the form of selfish desires. There is brightness because it is able to reflect the light of the self, the awareness of the self, without any hinderance. There is health because it enables us to get as close to our natural state of joy as is possible in the human body.
 
Now, no matter how enjoyable or pleasant this state is, Shri Krishna reminds us that sattva has the ability to bind us, to trap us, because anyone will like to remain in a state of joy and calmness. Furthermore, if we foresee that this state will go away, we would like to hold on to this state of joy tightly and not let it go. Sattva can also bind us through attachment to knowledge. Since sattva enables our mind to accumulate more and more worldly knowledge, read more books, attain more academic qualifications, and ultimately pump up our ego, we get attached to it even more.
 
Why is sattva able to bind us to joy and knowledge? We mistake the joy provided by sattva because we have not experienced what real joy is. That can only happen in meditation when we are able to access the joy that is inherent in the “I”, in the self. All other joys are in the realm of Prakriti - temporary, perishable, and illusory. True joy is in the subject, the “I”, not in the object. Sattva, though preferable to rajas and tamas, is to be used for getting us closer to the goal of liberation, and has to be ultimately discarded, just like the fire is turned off after we cook our meal.

Sunday, February 10, 2013

Bhagavad Gita Verse 5, Chapter 14

sattvam rajastama iti gunaahaa prakritisambhavaahaa |
nibandhanti mahaabaaho dehe dehinamavyayam || 5 ||

 
Sattva, rajas, tamas, these gunaas born of Prakriti, O mighty-armed warrior, bind the imperishable body dweller to the body.
 
sattvam : sattva
rajaha : rajas
tamaha : tamas
iti : these
gunaahaa : gunaas
prakritisambhavaahaa : born of Prakriti
nibandhanti : bind
mahaabaaho : O mighty-armed warrior
dehe : to the body
dehinam : body dweller
avyayam : imperishable
 
Shri Krishna beings the detailed analysis of Prakriti with two points. First, he breaks down Prakriti into its three components: the gunaas which are sattva, rajas and tamas. We have to note that the phrase “born of” in the shloka does not mean that Prakriti creates the three gunaas. It means that Prakriti itself is nothing but the three gunaas. Next, Shri Krishna states the effect of Prakriti on the Purusha, also known as the jeeva, the individual soul. He says that Prakriti binds or ties down the imperishable body dweller, the "dehi", the jeeva, to the body.
 
Let us begin by understanding what the term “gunaa” means. From our point of view, gunaa is a state of mind. In just one day, we experience calmness, passion and lethargy, which are roughly equal to sattva, rajas and tamas respectively. From a broader point of view, gunaas refer to building blocks of the universe. Inert matter is tamas, action or dynamism is rajas, and harmony is sattva. Since we are primarily interested in liberation from our sorrow, we shall focus on the impact of the gunaas on our mind rather than their impact on the universe.
 
Now, if we have repeatedly heard that our self is imperishable and can never be bound, then how can the perishable gunaas bind the self? The answer is : the gunaas by themselves do not bind us. Ignorance of our true nature, followed by our mis-identification with the body, puts us in a situation where we ourselves allow the gunaas to take over control of our life.
 
Imagine that you have parked your car on the left side of road. A car that looks just like your car is also parked on the same road, but on the right side of the road. After you come out of the building and absent-mindedly think that the other car is yours, you are trapped. You see a new scratch on the car and get upset, you get a parking ticket and have to pay the fine, and so on. The other car has not “bound” you, but your incorrect knowledge has done so. We can also go back to the example of the child watching the boxing match. He is as though glued to the screen, while his grandmother is not. The TV does not bind him since it is is nothing but millions of red, blue and green dots of light. It is the child's strong identification with the boxer that binds him.
 
Similarly, the individual soul which has mis-identified itself with the body, gets entrapped in the play of the three gunaas. In the next three shlokas, Shri Krishna takes up each gunaa one by one, and explains its power to bind the body in detail.

Saturday, February 9, 2013

Bhagavad Gita Verse 4, Chapter 14

sarvayonishu kaunteya moortayaha sambhavantiyaahaa |
taasaam brahma mahadyoniraham beejapradaha pitaa || 4 ||

 
Of the many forms that are born from all wombs, O Kaunteya, the great brahman is their womb, I their seed-giving father.
 
sarvayonishu : all wombs
kaunteya : O Kaunteya
moortayaha : forms
sambhavanti : born
yaahaa : many
taasaam : of those
brahma : brahman
mahat : great
yonihi : womb
aham : I am
beejapradaha : seed giving
pitaa : father
 
We may be wondering, how does Ishvara split himself into his two aspects of awareness and matter or Prakriti? Doesn’t it sound far fetched? Something quite similar happens to us every night. When we dream, our minds splits, as it were, into two. One aspect becomes the watcher, and the other aspect projects our dreams. In other words, the mind watches its own show. The Mandukya upanishad provides a detailed comparison of our waking, dreaming and deep sleep states.
 
Shri Krishna says that Ishvara, having divided himself into his two aspects, is both the mother and father of every thing and every living being in the universe. After he deposits the seeds or the jeevas into Prakriti, he creates the state of Hiranyagarbha. This state contains the potential to generate an entire sequence of creation, sustenance and dissolution of several universes. It is comparable to a DVD that contains within it the potential to create an entire two hour movie with several characters and locations.
 
Also, the ultimate womb, the ultimate source of the birth of all beings is the great brahman or Prakriti, which is nothing but the three gunaas. If we have to remove the impact and influence that the three gunaas exert upon us, we need to study what they are, how they impact us, how we fall under their sway, and how does one remain unaffected by them. Shri Krishna, having summarized the relevance of the three gunaas, proceeds to analyze the three gunaas in significant detail from the next shloka.

Friday, February 8, 2013

Bhagavad Gita Verse 3, Chapter 14

mama yonirmahadbrahma tasmingarbham dadhaamyaham |
sambhavaha sarvabhootaanaam tato bhavati bhaarata || 3 ||

 
My womb is the great brahman. In it, I place the seed. From that, O Bharaata, is the birth of all beings.
 
mama : my
yonihi : womb
mahadbrahma : great brahman
tasmin : in it
garbham : seed
dadhaami : place
aham : I
sambhavaha : birth
sarvabhootaanaam : all beings
tataha : from that
bhavati : happens
bhaarata : O Bhaarata
 
According to the theory of karma, each jeeva or individual soul generates new unfulfilled desires or vaasanaas. These vaasanaas are created as a result of karma phala or fruits of action. Each action of eating a sweet creates a new desire to eat a sweet later, for instance. One lifetime is not enough to exhaust these vaasanaas, causing the jeeva to continuously take birth in the world to fulfill its desires. This is the explanation of birth and rebirth of jeevas. But how does the universe itself begin? Shri Krishna describes this topic in extremely poetic language in two shlokas.
 
Ishvara, at the beginning of creation, splits himself into his two aspects. One aspect is Prakriti, referred to here as the "great brahman", which comprises three gunaas or qualities. Prakriti has the power to generate an infinite variety of forms through innumerable permutations and combinations of its three gunaas. But it is inert. It cannot create the universe by itself. The awareness aspect of Ishvara, the kshetrajnya, is needed to infuse Prakriti with life. This happens when Ishvara places all of the jeevas into Prakriti, just like seeds are placed into soil.
 
Let’s examine this in more detail. How exactly does the jeeva come into contact with Prakriti? It is due to avidyaa or ignorance. Each jeeva’s vaasanaas or unfulfilled desires are caused by its ignorance of its true nature which is infinite. Instead, the jeeva, also known as the Purusha, thinks that it is incomplete, and mistakenly rushes out into Prakriti to make itself complete again. This illusory link between the Purusha and Prakriti becomes the source of its birth and rebirth in the cycle of samsaara.

Thursday, February 7, 2013

Bhagavad Gita Verse 2, Chapter 14

idam jnyaanamupaashritya mama saadharmyamagataahaa |
sargepi nopajaayante pralaye na vyathanti cha || 2 ||

 
Those who have taken refuge in this knowledge, and have attained identity with me, are not born even during creation, and not afflicted during dissolution.
 
idam : this
jnyaanam : knowledge
upaashritya : taken refuge
mama : my
saadharmyam : identity
aagataahaa : attained
sarge : creation
api : even
na : not
upajaayante : born
pralaye : dissolution
na : not
vyathanti : afflicted
cha : and
 
Actors who work in the daily soap opera world lead interested lives. If an actor is selected to play a part in a well-established and long running soap, they are overjoyed since their career has just skyrocketed. But once the actor is selected, they are afraid when they read each day’s script, since their role can be killed off at any time by the director. The director and actor have two different visions. The director is concerned with moving the story forward, whereas the actor is concerned with preserving his role.
 
Now, if we identify with the various roles or the various parts that we play each day, we will face a fate similar to that of the actor. We experience birth and death every day, every minute, throughout our lives. When we get a new job, for instance, a new "senior manager of marketing" is born. When we lose that job, that senior manager "dies". If a marriage happens in the family, several new "in-laws" are born. If something goes wrong in that marriage, all those in-laws "die". If something makes us angry, an angry man is born, and will die in a short while once the anger dissipates. Birth and death are part and parcel of Prakriti's functioning.
 
Shri Krishna urges us to identify with Ishvara so that we are not disturbed or agitated when any kind of birth or death, even that of our own body, occurs. If the actor has the same vision as the director, he will take the end of his role in good stead and go on to do a wonderful job in his next assignment. If we have removed our ignorance through knowledge, if we have realized our true nature as identical to that of Ishvara, we will see things from Ishvara’s perspective and stop identifying with the ups and downs experienced by our body.
 
How exactly does this creation, this birth take place? Shri Krishna explains next.

Wednesday, February 6, 2013

Bhagavad Gita Verse 1, Chapter 14

Shree Bhagavaan uvaacha:
param bhooyaha pravakshyaami jnyaanaam jnyaanamuttamam |
yajnyaatvaa munayaha sarve paraam siddhimito gataahaa || 1 ||

 
Shree Bhagavaan said:
I shall again speak of that highest knowledge which is superior to any other knowledge. Having known this, all the sages, (liberated) from here, have attained the highest accomplishment.

 
param : highest
bhooyaha : again
pravakshyaami : speak
jnyaanaam : knowledge
jnyaanamuttamam : superior to any knowledge
yajnyaatvaa : having known
munayaha : sages
sarve : all
paraam : highest
siddhim : accomplishment
itaha : here
gataahaa : attained
 
Shri Krishna described the fundamental ignorance of our true nature in the previous chapter. The supreme self, which is our true nature, mistakenly identifies itself with one body within Prakriti or Maaya and becomes the Purusha. It further gets trapped in Prakriti when it gets enchanted by play of the three gunaas of Prakriti. Shri Krishna uses this chapter to explain the nature of these three gunaas, their characteristics, their effects and their remedy in detail.
 
This shloka is in the form of "anubandha chatushtaya", the four-fold curriculum covered in a text. It systematically lists the subject matter of the chapter, the student who is qualified to study this chapter, the goal of this chapter and the relationship of the subject to the goal. The subject matter is brahmavidyaa or the knowledge of brahman. One who is a muni, one who has a contemplative mind, is fit to study this chapter. The highest accomplishment one can aspire to - liberation from sorrow - is the goal of this chapter. When we know brahman as our our own self, the goal is attained. This is the prayojanam, the relationship of the subject matter to the goal of this chapter.
 
Before the topic is begun, however, we notice that Shri Krishna repeats the statement that he has made in earlier chapters about the glory of this knowledge. He does so because knowledge for us usually means academic, professional or any other type of worldly knowledge. It is always knowledge about some person, object, substance, concept, technique, something that can be accessed with the senses and mind. However, the knowledge of the self is that knowledge that reveals what the subject is, what the “I” is. In order to remove this hard conditioning, this deep programming within us, Shri Krishna has to repeat the importance of this knowledge.

Tuesday, February 5, 2013

Summary of Bhagavad Gita Chapter 13

Shri Krishna begins the chapter by describing what is meant by the field and the knower of the field, kshetra and kshetrajnya. He reminds us that this knowledge is not something new, that it has come directly from the Vedas and the Brahma Sutras. He then describes the field in detail by listing its modifications such as the great elements, the ego, the senses and so on. A list of attributes or qualities that are needed in order to escape the influence of the field is given. These qualities include humility, lack of arrogance and so on. These qualities are termed as "jnyaanam" or means of knowledge.
 
The topic of the supreme self, brahman, the knower of the field or kshetrajnya, is taken up next. The "sat" or existence aspect of brahman is indicated first with attributes such as hands, legs and so on. It is then indicated with negation of those same attributes, following the "adhyaaropa apavaada" technique used in Vedanta. Brahman, which can never become an object of our knowledge, is explained through a series of paradoxes - it is near, yet it is far and so on. The "chit" or awareness aspect of brahman is also highlighted using the phrase "it is the light of all lights".
 
The field and its knower are now explained from the point of view of the individualized self, jeeva by using the terminology of Purusha and Prakriti. Shri Krishna first defines these terms, points out their beginningless nature, and also points out how they become the cause of enjoyership and doership respectively. The fall of the immaculate supreme self is explained by the apparent relationship of Purusha and Prakriti due to ignorance of our true nature as the supreme self that resides as Ishvara in all bodies. Release from this ignorance leads to liberation.
 
In order to get to a stage where we can discriminate or distinguish between the field and its knower, we have to go through a curriculum of saadhanaa or spiritual practice. Shri Krishna provides this roadmap of steps as karma, bhakti, raaja and saankhya yoga. The key thing, however, is to orient or attach ourselves to the imperishable Ishvara, and to detach ourselves from identification with Prakriti, which is the storehouse of all action and diversity.
 
Shri Krishna concludes the chapter with two illustrations highlighting the existence and awareness, the sat and chit aspects of the supreme self. The analogy of space is used to illustrate the all-pervading, unattached, untainted and singular nature of the supreme self. The analogy of the sun is used to illustrate the knowledge, awareness and non-acting nature of the supreme self. The chapter ends by asserting that the fruit of knowing the true nature of the supreme self is moksha or liberation.

Monday, February 4, 2013

Bhagavad Gita Verse 34, Chapter 13

kshetrakshetrajnyayorevamantaram jnyaanachakshushaa |
bhootaprakritimoksham cha ye viduryanti te param || 34 ||

 
Those who, by the eye of wisdom, perceive the distinction between the field and its knower in this manner, and relinquishment from the cause of all beings, they attain the supreme.
 
kshetrakshetrajnyayoho : field and its knower
evam : in this manner
antaram : distinction
jnyaanachakshushaa : eye of wisdom
bhootaprakriti : cause of all beings
moksham : relinquishment
cha : and
ye : those who
viduhu : perceive
yanti : attain
te : they
param : supreme
 
After having understood the true nature of the self, the nature of the ignorance we are in, and also having understood the method of how to remove this ignorance, what is the result? Shri Krishna concludes this chapter by asserting that the one who has removed his ignorance through knowledge attain the supreme, which is moksha or liberation from the cycle of Prakriti’s creation and dissolution. The key to understanding this chapter is "viveka", or discrimination, which was hinted at the beginning of this chapter by the words "idam shareera" or "this body".
 
Take the case of a forensic investigator who is hired to detect counterfeit currency notes. On the first day of his job, he will not be able to spot the difference between a fake note and a genuine note. After learning about the visual differences between what’s fake and what’s genuine, and after practising to spot those differences over a period of time, his eye will begin to see minute details that the average eye cannot see. This ability to separate the real from the unreal is discrimination, which is the “eye of wisdom” mentioned in the shloka.
 
So then, the one who knows how to conduct his life in a manner such that he can distinguish between the unreal aspects and the real aspects, between the field and its knower, between Purusha and Prakriti, and learn to see the imperishable in the perishable as Ishvara, such a person is freed of the mechanisms of Prakriti, the cause of all beings. This is the goal of jnyaana yoga, which is summarized in the thirteenth chapter of the Gita. We will be able to attain this goal if we bring this teaching into our lives through constant reflection and meditation.
 
om tatsatiti shreematbhagavatgitasupanishadsu brahmavidyaayaam yogashaastre shreekrishnaarjunsamvade kshetrakshetrajnyavibhaagayogo naama trayodashodhyaayaha || 13 ||

Sunday, February 3, 2013

Bhagavad Gita Verse 33, Chapter 13

yathaa prakaashayatyekaha kritsnam lokamimam ravihi |
kshetram kshetree tathaa kritsnam prakaashayati bhaarata || 33 ||

 
Just as the one sun illumines the entire world, so does the knower of the field illumine the entire field, O Bhaarata.
 
yathaa : just as
prakaashayati : illumines
ekaha : the one
kritsnam : entire
lokam : world
imam : this
ravihi : sun
kshetram : field
kshetree : knower of the field
tathaa : so does
kritsnam : entire
prakaashayati : illumines
bhaarata : O Bhaarata
 
The example of space in the previous shloka was meant to illustrate the unaffected and untainted nature of the self. In this shloka, the example of the sun is given to highlight the actionless nature of the self. The sun is located millions of miles away from the earth, yet it enables life on earth to exist. Minerals, plants, animals and humans, everything and every being survives only from the sun’s energy. But the sun never acts. All of the actions happen on our planet distinct and separate from the sun.
 
Shri Krishna says that the self in us, the "I" in us is similar in nature to the sun. The self or the knower of the field, the kshetrajnya, illumines or knows the actions taking place in the kshetra, the field, our body, which is a part of Prakriti. Furthermore, the self does not take on the notion of pride or doership in the actions of the body, neither does it get differentiated due to the differences or modifications of Prakriti, just like the sun never claims doership nor gets differentiated due to the variety of form on our planet.
 
So, if the self is the sole knower of all of the actions in our body, how does our intellect know things? With respect to the analogy of the sun, the intellect can be compared to a pool of water that reflects the light of the sun. The intellect is just an instrument that functions due to tje knowledge of the self. If the intellect is calm and steady, it works perfectly in interpreting the information sent to it from the mind and senses. If it is agitated or dull, it cannot work perfectly, just like the sun’s reflection is disturbed when the pool of water is agitated or muddy.
 
Here, Shri Krishna asserts that the self is of the nature of "chit". It is knowledge, awareness, consciousness personified.

Saturday, February 2, 2013

Bhagavad Gita Verse 32, Chapter 13

yathaa sarvagatam saukshmyaadaakaasham nopalipyate |
sarvatraavasthito dehe tathaatmaa nopalipyate || 32 ||

 
Just as all-pervading space, being subtle, is not tainted, so is the self, situated everywhere in any body, not tainted.
 
yathaa : just as
sarvagatam : all pervading
saukshmyaat : being subtle
aakaasham : space
na : not
upalipyate : tainted
sarvatra : everywhere
avasthitaha : situated
dehe : body
tathaa : so
aatmaa : self
na : not
upalipyate : tainted
 
Many scriptures, including the Srimad Bhagavatam, describe the creation of the five great elements. Space was created first, followed by air, fire, water and then earth, each more tangible and visible than the one preceding it. Space, therefore, is the subtlest of elements. Its main property is indivisibility. We may put up walls and differentiate "my room" from "your room", but the wall does not actually divide space at all. The wall is an upaadhi, something that mentally limits space, but cannot ever limit space in reality.
 
Another property of space that it is unaffected by whatever it contains. You can throw dust, water, glue, perfume, odour, anything at all into space, yet it remains unaffected. The air in a room may get affected by perfume or odour, not space. But more fundamentally, space provides existence to everything. Without space, no object can ever exist.
 
Shri Krishna says that the self is similar to space in these aspects. Like space is as though divided into rooms, the self is one but appears as though residing differently in different bodies. Like space never gets tainted by whatever is thrown at it, the self never gets impacted by the results, reactions, experiences and consequences of any action. All actions and reactions stay in the realm of Prakriti. And when we say statements like "this pot is round", we should note that we cannot use the word "is" without realizing that the "is" is the "sat" or existence aspect of the self.
 
How should we bring this teaching into our life? Ultimately, all of us are craving for independence of one form or the other. For instance, the incessant drive to earn more wealth is towards gaining financial independence. Shri Krishna says that once we know that the self in us, the "I" in us is totally unaffected by any reaction or experience of the world, we will gain the highest and utmost level of independence, which is moksha or liberation. We just have to work at removing the ignorance of our true nature, which can only happen if we disassociate from Prakriti and associate with Ishvara.

Friday, February 1, 2013

Bhagavad Gita Verse 31, Chapter 13

anaaditvaannirgunatvaatparamaatmaayamavyayaha |
shareerasthopi kaunteya na karoti na lipyate || 31 ||

 
Without beginning, without qualities, this supreme self is indestructible. Though residing in the body, O Kaunteya, it neither acts nor is tainted.
 
anaaditvaat : without beginning
nirgunatvaat : without qualities
paramaatmaa : supreme self
ayam : this
avyayaha : indestructible
shareerasthaha : residing in the body
api : even though
kaunteya : O Kaunteya
na : not
karoti: act
na : not
lipyate : tainted
 
As this chapter slowly comes to a close, Shri Krishna begins to describe the nature of the supreme self. Since this chapter gives prominence to logic, more so than any other chapter in the Gita, he wants to clear any doubts or misconceptions that we may harbour about the supreme self. The first doubt we may have is as follows. If Prakriti is without beginning, and the supreme self is also without beginning, what makes them different?
 
Shri Krishna says that the difference is cause by whether or not they have gunaas or qualities. So far, we have seen that Prakriti is nothing but the three gunaas of sattva, rajas and tamas. But the supreme self is “nirguna”, it has no association or association with any quality whatsoever. This is what makes it different than Prakriti. Also, Prakriti is constantly changing and perishing whereas the supreme self is imperishable. When something has association with qualities, like the human body has strength, it is bound to perish or decay. Since the supreme self has no qualities at all, it is imperishable. Prakriti, on the other hand, is every changing and perishable.
 
Another doubt is as follows. Does the supreme self get affected by the actions and reactions of Prakriti? Shri Krishna asserts that it does not. We have seen that the supreme self, due to ignorance, identifies itself with a body, a product of Prakriti. This is what is referred to in this shloka - it “resides” in the body. We have also repeatedly heard that the supreme self has nothing to do with Prakriti. It can never become the doer or the enjoyer of any actions. But due to the apparent identification with the body, the supreme self assumes that it is a doer and enjoyer. Since the identification is fake, not real, the supreme self can never get affected by the actions and reactions by Prakriti.
 
We may have understood the non-doership and non-enjoyership of the supreme self in theory, but it is still a little fuzzy. We need to clearly understand how the supreme self, in its real nature neither acts, nor experiences the results of its actions. To better explain this, Shri Krishna provides an illustration in the next shloka.